OLAH (NM_001039702) Human Mass Spec Standard
CAT#: PH308251
OLAH MS Standard C13 and N15-labeled recombinant protein (NP_001034791)
View other "OLAH" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | OLAH MS Standard C13 and N15-labeled recombinant protein (NP_001034791) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208251 |
| Predicted MW | 29.9 kDa |
| Protein Sequence |
>RC208251 protein sequence
Red=Cloning site Green=Tags(s) MERGDQPKRTRNENIFNCLYKNPEATFKLICFPWMGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEP LENDISQLVDEVVCALQPVIQDKPFAFFGHSMGSYIAFRTALGLKENNQPEPLHLFLSSATPVHSKAWHR IPKDDELSEEQISHYLMEFGGTPKHFAEAKEFVKQCSPIIRADLNIVRSCTSNVPSKAVLSCDLTCFVGS EDIAKDMEAWKDVTSGNAKIYQLPGGHFYLLDPANEKLIKNYIIKCLEVSSISNF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001034791 |
| RefSeq Size | 1675 |
| RefSeq ORF | 795 |
| Synonyms | AURA1; SAST; TE2; THEDC1 |
| Locus ID | 55301 |
| Cytogenetics | 10p13 |
| Summary | Contributes to the release of free fatty acids from fatty acid synthase (FASN). Has broad substrate specificity, giving rise to a range of free fatty acids with chain lengths between 10 and 16 carbon atoms (C10 - C16).[UniProtKB/Swiss-Prot Function] |
| Protein Pathways | Fatty acid biosynthesis, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400421 | OLAH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC413121 | OLAH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400421 | Transient overexpression lysate of oleoyl-ACP hydrolase (OLAH), transcript variant 2 |
CNY 3080.00 |
|
| LY413121 | Transient overexpression lysate of oleoyl-ACP hydrolase (OLAH), transcript variant 1 |
CNY 3080.00 |
|
| TP308251 | Recombinant protein of human oleoyl-ACP hydrolase (OLAH), transcript variant 2, 20 µg |
CNY 2900.00 |
