XRCC2 (NM_005431) Human Mass Spec Standard
CAT#: PH308330
XRCC2 MS Standard C13 and N15-labeled recombinant protein (NP_005422)
View other "XRCC2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | XRCC2 MS Standard C13 and N15-labeled recombinant protein (NP_005422) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208330 |
| Predicted MW | 32 kDa |
| Protein Sequence |
>RC208330 protein sequence
Red=Cloning site Green=Tags(s) MCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPEGTGKTEMLYHLTARCILPKS EGGLEVEVLFIDTDYHFDMLRLVTILEHRLSQSSEEIIKYCLGRFFLVYCSSSTHLLLTLYSLESMFCSH PSLCLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFATTQTIMQKASSSSEEPS HASRRLCDVDIDYRPYLCKAWQQLVKHRMFFSKQDDSQSSNQFSLVSRCLKSNSLKKHFFIIGESGVEFC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005422 |
| RefSeq Size | 3094 |
| RefSeq ORF | 840 |
| Synonyms | FANCU; POF17; SPGF50 |
| Locus ID | 7516 |
| Cytogenetics | 7q36.1 |
| Summary | This gene encodes a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene is involved in the repair of DNA double-strand breaks by homologous recombination and it functionally complements Chinese hamster irs1, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Homologous recombination |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417301 | XRCC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417301 | Transient overexpression lysate of X-ray repair complementing defective repair in Chinese hamster cells 2 (XRCC2) |
CNY 3080.00 |
|
| TP308330 | Recombinant protein of human X-ray repair complementing defective repair in Chinese hamster cells 2 (XRCC2), 20 µg |
CNY 2900.00 |
