PRKX (NM_005044) Human Mass Spec Standard
CAT#: PH308332
PRKX MS Standard C13 and N15-labeled recombinant protein (NP_005035)
View other "PRKX" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | PRKX MS Standard C13 and N15-labeled recombinant protein (NP_005035) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208332 |
Predicted MW | 40.9 kDa |
Protein Sequence |
>RC208332 protein sequence
Red=Cloning site Green=Tags(s) MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFDTLATVGTGTFGRVHLVKEKT AKHFFALKVMSIPDVIRLKQEQHVHNEKSVLKEVSHPFLIRLFWTWHDERFLYMLMEYVPGGELFSYLRN RGRFSSTTGLFYSAEIICAIEYLHSKEIVYRDLKPENILLDRDGHIKLTDFGFAKKLVDRTWTLCGTPEY LAPEVIQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNPFGIYQKILAGKIDFPRHLDFHVKDLIKKLLV VDRTRRLGNMKNGANDVKHHRWFRSVDWEAVPQRKLKPPIVPKIAGDGDTSNFETYPENDWDTAAPVPQK DLEIFKNF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005035 |
RefSeq Size | 6084 |
RefSeq ORF | 1074 |
Synonyms | PKX1 |
Locus ID | 5613 |
Cytogenetics | Xp22.33 |
Summary | This gene encodes a serine threonine protein kinase that has similarity to the catalytic subunit of cyclic AMP dependent protein kinases. The encoded protein is developmentally regulated and may be involved in renal epithelial morphogenesis. This protein may also be involved in macrophage and granulocyte maturation. Abnormal recombination between this gene and a related pseudogene on chromosome Y is a frequent cause of sex reversal disorder in XX males and XY females. Pseudogenes of this gene are found on chromosomes X, 15 and Y. [provided by RefSeq, Feb 2010] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Apoptosis, Calcium signaling pathway, Chemokine signaling pathway, Dilated cardiomyopathy, Gap junction, GnRH signaling pathway, Hedgehog signaling pathway, Insulin signaling pathway, Long-term potentiation, MAPK signaling pathway, Melanogenesis, Olfactory transduction, Oocyte meiosis, Prion diseases, Progesterone-mediated oocyte maturation, Taste transduction, Vascular smooth muscle contraction, Vibrio cholerae infection, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401566 | PRKX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401566 | Transient overexpression lysate of protein kinase, X-linked (PRKX) |
CNY 3080.00 |
|
TP308332 | Recombinant protein of human protein kinase, X-linked (PRKX), 20 µg |
CNY 2900.00 |