Alpha 1 microglobulin (AMBP) (NM_001633) Human Mass Spec Standard
CAT#: PH308342
AMBP MS Standard C13 and N15-labeled recombinant protein (NP_001624)
View other "Alpha 1 microglobulin" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | AMBP MS Standard C13 and N15-labeled recombinant protein (NP_001624) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208342 |
| Predicted MW | 39 kDa |
| Protein Sequence |
>RC208342 protein sequence
Red=Cloning site Green=Tags(s) MRSLGALLLLLSACLAVSAGPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVL GEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSR HHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVRRAVLPQ EEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQT CRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRF SN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001624 |
| RefSeq Size | 1450 |
| RefSeq ORF | 1056 |
| Synonyms | A1M; EDC1; HCP; HI30; IATIL; ITI; ITIL; ITILC; UTI |
| Locus ID | 259 |
| Cytogenetics | 9q32 |
| Summary | This gene encodes a complex glycoprotein secreted in plasma. The precursor is proteolytically processed into distinct functioning proteins: alpha-1-microglobulin, which belongs to the superfamily of lipocalin transport proteins and may play a role in the regulation of inflammatory processes, and bikunin, which is a urinary trypsin inhibitor belonging to the superfamily of Kunitz-type protease inhibitors and plays an important role in many physiological and pathological processes. This gene is located on chromosome 9 in a cluster of lipocalin genes. [provided by RefSeq, Jul 2008] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400613 | AMBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400613 | Transient overexpression lysate of alpha-1-microglobulin/bikunin precursor (AMBP) |
CNY 3080.00 |
|
| TP308342 | Recombinant protein of human alpha-1-microglobulin/bikunin precursor (AMBP), 20 µg |
CNY 2900.00 |
其它Alpha 1 microglobulin产品
