Fetuin A (AHSG) (NM_001622) Human Mass Spec Standard
CAT#: PH308344
AHSG MS Standard C13 and N15-labeled recombinant protein (NP_001613)
View other "Fetuin A" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | AHSG MS Standard C13 and N15-labeled recombinant protein (NP_001613) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208344 |
| Predicted MW | 39.3 kDa |
| Protein Sequence |
>RC208344 protein sequence
Red=Cloning site Green=Tags(s) MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWP QQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAE DVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVA KEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPS PPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAA AGPVVPPCPGRIRHFKV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001613 |
| RefSeq Size | 1594 |
| RefSeq ORF | 1101 |
| Synonyms | A2HS; AHS; APMR1; FETUA; HSGA |
| Locus ID | 197 |
| Cytogenetics | 3q27.3 |
| Summary | The protein encoded by this gene is a negatively-charged serum glycoprotein that is synthesized by hepatocytes. The encoded protein consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several processes, including endocytosis, brain development, and the formation of bone tissue. Defects in this gene are a cause of susceptibility to leanness. [provided by RefSeq, Aug 2017] |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400610 | AHSG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400610 | Transient overexpression lysate of alpha-2-HS-glycoprotein (AHSG) |
CNY 3080.00 |
|
| TP308344 | Recombinant protein of human alpha-2-HS-glycoprotein (AHSG), 20 µg |
CNY 2900.00 |
|
| TP720359 | Recombinant protein of human alpha-2-HS-glycoprotein (AHSG) |
CNY 1800.00 |
其它Fetuin A产品
