ROR beta (RORB) (NM_006914) Human Mass Spec Standard
CAT#: PH308666
RORB MS Standard C13 and N15-labeled recombinant protein (NP_008845)
View other "ROR beta" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | RORB MS Standard C13 and N15-labeled recombinant protein (NP_008845) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208666 |
| Predicted MW | 52.1 kDa |
| Protein Sequence |
>RC208666 protein sequence
Red=Cloning site Green=Tags(s) MRAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQRNCLIDRTNRNRCQHCRLQKC LALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQRLQEQRQQQSGEAEALARVYSSSISNGLSNLNNETSGT YANGHVIDLPKSEGYYNVDSGQPSPDQSGLDMTGIKQIKQEPIYDLTSVPNLFTYSSFNNGQLAPGITMT EIDRIAQNIIKSHLETCQYTMEELHQLAWQTHTYEEIKAYQSKSREALWQQCAIQITHAIQYVVEFAKRI TGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLNNTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNLC SLQLTEEEIALFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKLIAKIPTITAVC NLHGEKLQVFKQSHPEIVNTLFPPLYKELFNPDCATGCK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_008845 |
| RefSeq Size | 3604 |
| RefSeq ORF | 1377 |
| Synonyms | bA133M9.1; EIG15; NR1F2; ROR-BETA; RZR-BETA; RZRB |
| Locus ID | 6096 |
| Cytogenetics | 9q21.13 |
| Summary | The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It is a DNA-binding protein that can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The encoded protein has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, and to help regulate the expression of some genes involved in circadian rhythm. [provided by RefSeq, Feb 2014] |
| Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402058 | RORB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402058 | Transient overexpression lysate of RAR-related orphan receptor B (RORB) |
CNY 3080.00 |
|
| TP308666 | Recombinant protein of human RAR-related orphan receptor B (RORB), 20 µg |
CNY 2900.00 |
其它ROR beta产品
