PEG10 (NM_001040152) Human Mass Spec Standard
CAT#: PH308683
PEG10 MS Standard C13 and N15-labeled recombinant protein (NP_001035242)
View other "PEG10" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
Product Data | |
Description | PEG10 MS Standard C13 and N15-labeled recombinant protein (NP_001035242) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208683 |
Predicted MW | 37 kDa |
Protein Sequence |
>RC208683 protein sequence
Red=Cloning site Green=Tags(s) MTERRRDELSEEINNLREKVMKQSEENNNLQSQVQKLTEENTTLREQVEPTPEDEDDDIELRGAAAAAAP PPPIEEECPEDLPEKFDGNPDMLAPFMAQCQIFMEKSTRDFSVDRVRVCFVTSMMTGRAARWASAKLERS HYLMHNYPAFMMEMKHVFEDPQRREVAKRKIRRLRQGMGSVIDYSNAFQMIAQDLDWNEPALIDQYHEGL SDHIQEELSHLEVAKSLSALIGQCIHIERRLARAAAARKPRSPPRALVLPHIASHHQVDPTEPVGGARMR LTQEEKERRRKLNLCLYCGTGGHYADNCPAKASKSSPAGNSPAPL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001035242 |
RefSeq Size | 6628 |
RefSeq ORF | 975 |
Synonyms | EDR; HB-1; Mar2; Mart2; MEF3L; RGAG3; RTL2; SIRH1 |
Locus ID | 23089 |
Cytogenetics | 7q21.3 |
Summary | This is a paternally expressed imprinted gene that is thought to have been derived from the Ty3/Gypsy family of retrotransposons. It contains two overlapping open reading frames, RF1 and RF2, and expresses two proteins: a shorter, gag-like protein (with a CCHC-type zinc finger domain) from RF1; and a longer, gag/pol-like fusion protein (with an additional aspartic protease motif) from RF1/RF2 by -1 translational frameshifting (-1 FS). While -1 FS has been observed in RNA viruses and transposons in both prokaryotes and eukaryotes, this gene represents the first example of -1 FS in a eukaryotic cellular gene. This gene is highly conserved across mammalian species and retains the heptanucleotide (GGGAAAC) and pseudoknot elements required for -1 FS. It is expressed in adult and embryonic tissues (most notably in placenta) and reported to have a role in cell proliferation, differentiation and apoptosis. Overexpression of this gene has been associated with several malignancies, such as hepatocellular carcinoma and B-cell lymphocytic leukemia. Knockout mice lacking this gene showed early embryonic lethality with placental defects, indicating the importance of this gene in embryonic development. Additional isoforms resulting from alternatively spliced transcript variants, and use of upstream non-AUG (CUG) start codon have been reported for this gene. [provided by RefSeq, Oct 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421697 | PEG10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432935 | PEG10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421697 | Transient overexpression lysate of paternally expressed 10 (PEG10), transcript variant 1 |
CNY 3080.00 |
|
LY432935 | Transient overexpression lysate of paternally expressed 10 (PEG10), transcript variant 1 |
CNY 3080.00 |
|
TP308683 | Recombinant protein of human paternally expressed 10 (PEG10), transcript variant 1, 20 µg |
CNY 2900.00 |