MTMR2 (NM_016156) Human Mass Spec Standard
CAT＃: PH308703
MTMR2 MS Standard C13 and N15-labeled recombinant protein (NP_057240)
View other "MTMR2" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | MTMR2 MS Standard C13 and N15-labeled recombinant protein (NP_057240) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208703 |
| Predicted MW | 73.4 kDa |
| Protein Sequence |
>RC208703 protein sequence
Red=Cloning site Green=Tags(s) METSSSCESLGSQPAAARPPSVDSLSSASTSHSENSVHTKSASVVSSDSISTSADNFSPDLRVLRESNKL AEMEEPPLLPGENIKDMAKDVTYICPFTGAVRGTLTVTNYRLYFKSMERDPPFVLDASLGVINRVEKIGG ASSRGENSYGLETVCKDIRNLRFAHKPEGRTRRSIFENLMKYAFPVSNNLPLFAFEYKEVFPENGWKLYD PLLEYRRQGIPNESWRITKINERYELCDTYPALLVVPANIPDEELKRVASFRSRGRIPVLSWIHPESQAT ITRCSQPMVGVSGKRSKEDEKYLQAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVF LDIHNIHVMRESLRKLKEIVYPNIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDG WDRTAQLTSLAMLMLDGYYRTIRGFEVLVEKEWLSFGHRFQLRVGHGDKNHADADRSPVFLQFIDCVWQM TRQFPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGKENLPKRTVSLWSYINSQLEDFTNPLYGSYS NHVLYPVASMRHLELWVGYYIRWNPRMKPQEPIHNRYKELLAKRAELQKKVEELQREISNRSTSSSERAS SPAQCVTPVQTVV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057240 |
| RefSeq Size | 4603 |
| RefSeq ORF | 1929 |
| Synonyms | CMT4B; CMT4B1 |
| Locus ID | 8898 |
| Cytogenetics | 11q21 |
| Summary | This gene is a member of the myotubularin family of phosphoinositide lipid phosphatases. The encoded protein possesses phosphatase activity towards phosphatidylinositol-3-phosphate and phosphatidylinositol-3,5-bisphosphate. Mutations in this gene are a cause of Charcot-Marie-Tooth disease type 4B, an autosomal recessive demyelinating neuropathy. Alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. [provided by RefSeq, Aug 2011] |
| Protein Families | Druggable Genome, Phosphatase |
| Protein Pathways | Fructose and mannose metabolism, Metabolic pathways, Riboflavin metabolism, Thiamine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404513 | MTMR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC414151 | MTMR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430848 | MTMR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404513 | Transient overexpression lysate of myotubularin related protein 2 (MTMR2), transcript variant 3 |
CNY 3080.00 |
|
| LY414151 | Transient overexpression lysate of myotubularin related protein 2 (MTMR2), transcript variant 1 |
CNY 3080.00 |
|
| PH314811 | MTMR2 MS Standard C13 and N15-labeled recombinant protein (NP_958438) |
CNY 19520.00 |
|
| TP308703 | Recombinant protein of human myotubularin related protein 2 (MTMR2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP314811 | Recombinant protein of human myotubularin related protein 2 (MTMR2), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP324099 | Recombinant protein of human myotubularin related protein 2 (MTMR2), transcript variant 2, 20 µg |
CNY 2900.00 |
