RHOC (NM_001042678) Human Mass Spec Standard
CAT#: PH308751
RHOC MS Standard C13 and N15-labeled recombinant protein (NP_001036143)
View other "RHOC" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
Product Data | |
Description | RHOC MS Standard C13 and N15-labeled recombinant protein (NP_001036143) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208751 |
Predicted MW | 22 kDa |
Protein Sequence |
>RC208751 protein sequence
Red=Cloning site Green=Tags(s) MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLR PLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVR SEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001036143 |
RefSeq Size | 1346 |
RefSeq ORF | 579 |
Synonyms | ARH9; ARHC; H9; RHOH9 |
Locus ID | 389 |
Cytogenetics | 1p13.2 |
Summary | This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403579 | RHOC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421019 | RHOC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421020 | RHOC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403579 | Transient overexpression lysate of ras homolog gene family, member C (RHOC), transcript variant 1 |
CNY 3080.00 |
|
LY421019 | Transient overexpression lysate of ras homolog gene family, member C (RHOC), transcript variant 2 |
CNY 3080.00 |
|
LY421020 | Transient overexpression lysate of ras homolog gene family, member C (RHOC), transcript variant 3 |
CNY 3080.00 |
|
PH300332 | RHOC MS Standard C13 and N15-labeled recombinant protein (NP_001036144) |
CNY 19520.00 |
|
PH317556 | RHOC MS Standard C13 and N15-labeled recombinant protein (NP_786886) |
CNY 19520.00 |
|
TP300332 | Recombinant protein of human ras homolog gene family, member C (RHOC), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP308751 | Recombinant protein of human ras homolog gene family, member C (RHOC), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP317556 | Recombinant protein of human ras homolog gene family, member C (RHOC), transcript variant 1, 20 µg |
CNY 2900.00 |