LIN7C (NM_018362) Human Mass Spec Standard
CAT#: PH308758
LIN7C MS Standard C13 and N15-labeled recombinant protein (NP_060832)
View other "LIN7C" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | LIN7C MS Standard C13 and N15-labeled recombinant protein (NP_060832) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208758 |
| Predicted MW | 21.7 kDa |
| Protein Sequence |
>RC208758 representing NM_018362
Red=Cloning site Green=Tags(s) MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYETVDISSSPEVR ANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQL LSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEEMESRFEKMRSAKRRQQT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_060832 |
| RefSeq Size | 4729 |
| RefSeq ORF | 591 |
| Synonyms | LIN-7-C; LIN-7C; MALS-3; MALS3; VELI3 |
| Locus ID | 55327 |
| Cytogenetics | 11p14.1 |
| Summary | Plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. Forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. Ensures the proper localization of GRIN2B (subunit 2B of the NMDA receptor) to neuronal postsynaptic density and may function in localizing synaptic vesicles at synapses where it is recruited by beta-catenin and cadherin. Required to localize Kir2 channels, GABA transporter (SLC6A12) and EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 to the basolateral membrane of epithelial cells.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413114 | LIN7C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413114 | Transient overexpression lysate of lin-7 homolog C (C. elegans) (LIN7C) |
CNY 3080.00 |
|
| TP308758 | Recombinant protein of human lin-7 homolog C (C. elegans) (LIN7C), 20 µg |
CNY 2900.00 |
