DCUN1D4 (NM_015115) Human Mass Spec Standard
CAT#: PH308821
DCUN1D4 MS Standard C13 and N15-labeled recombinant protein (NP_055930)
View other "DCUN1D4" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | DCUN1D4 MS Standard C13 and N15-labeled recombinant protein (NP_055930) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208821 |
| Predicted MW | 30 kDa |
| Protein Sequence |
>RC208821 protein sequence
Red=Cloning site Green=Tags(s) MHSDAAAVNFQLNSHLSTLANIHKIYHTLNKLNLTEDIGQDDHQTGSLRSCSSSDCFNKVMPPRKKRRPA SGDDLSAKKSRHDSMYRKYDSTRIKTEEEAFSSKRCLEWFYEYAGTDDVVGPEGMEKFCEDIGVEPENVV MLVLAWKLDAQNMGYFTLQEWLKGMTSLQCDTTEKLRNTLDYLRSFLNDSTNFKLIYRYAFDFARQSKYK VINKDQWCNVLEFSRTINLDLSNYDEDGAWPVLLDEFVEWYKDKQMS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055930 |
| RefSeq Size | 4283 |
| RefSeq ORF | 771 |
| Locus ID | 23142 |
| Cytogenetics | 4q12 |
| Summary | Contributes to the neddylation of all cullins by transfering NEDD8 from N-terminally acetylated NEDD8-conjugating E2s enzyme to different cullin C-terminal domain-RBX complexes which are necessary for the activation of cullin-RING E3 ubiquitin ligases (CRLs).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414778 | DCUN1D4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421741 | DCUN1D4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414778 | Transient overexpression lysate of DCN1, defective in cullin neddylation 1, domain containing 4 (S. cerevisiae) (DCUN1D4), transcript variant 2 |
CNY 3080.00 |
|
| LY421741 | Transient overexpression lysate of DCN1, defective in cullin neddylation 1, domain containing 4 (S. cerevisiae) (DCUN1D4), transcript variant 1 |
CNY 3080.00 |
|
| TP308821 | Recombinant protein of human DCN1, defective in cullin neddylation 1, domain containing 4 (S. cerevisiae) (DCUN1D4), transcript variant 2, 20 µg |
CNY 2900.00 |
其它DCUN1D4产品
