PRR4 (NM_007244) Human Mass Spec Standard
CAT#: PH308870
PRR4 MS Standard C13 and N15-labeled recombinant protein (NP_009175)
View other "PRR4" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 3080.00
Specifications
Product Data | |
Description | PRR4 MS Standard C13 and N15-labeled recombinant protein (NP_009175) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208870 |
Predicted MW | 14.9 kDa |
Protein Sequence |
>RC208870 representing NM_007244
Red=Cloning site Green=Tags(s) MLLVLLSVVLLALSSAQSTDNDVNYEDFTFTIPDVEDSSQRPDQGPQRPPPEGLLPRPPGDSGNQDDGPQ QRPPKPGGHHRHPPPPPFQNQQRPPQRGHRQLSLPRFPSVSLQEASSFFRRDRPARHPQEQPLW myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_009175 |
RefSeq Size | 507 |
RefSeq ORF | 402 |
Synonyms | LPRP; PROL4 |
Locus ID | 11272 |
Cytogenetics | 12p13.2 |
Summary | This gene encodes a member of the proline-rich protein family that lacks a conserved repetitive domain. This protein may play a role in protective functions in the eye. Alternative splicing result in multiple transcript variants. Read-through transcription also exists between this gene and the upstream PRH1 (proline-rich protein HaeIII subfamily 1) gene. [provided by RefSeq, Feb 2011] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416104 | PRR4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420635 | PRR4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416104 | Transient overexpression lysate of proline rich 4 (lacrimal) (PRR4), transcript variant 2 |
CNY 3080.00 |
|
LY420635 | Transient overexpression lysate of proline rich 4 (lacrimal) (PRR4), transcript variant 1 |
CNY 3080.00 |
|
TP308870 | Purified recombinant protein of Homo sapiens proline rich 4 (lacrimal) (PRR4), transcript variant 2, 20 µg |
CNY 2900.00 |