EMG1 (NM_006331) Human Mass Spec Standard
CAT#: PH308885
EMG1 MS Standard C13 and N15-labeled recombinant protein (NP_006322)
View other "EMG1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | EMG1 MS Standard C13 and N15-labeled recombinant protein (NP_006322) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208885 |
| Predicted MW | 26.7 kDa |
| Protein Sequence |
>RC208885 protein sequence
Red=Cloning site Green=Tags(s) MAAPSDGFKPRERSGGEQAQDWDALPPKRPRLGAGNKIGGRRLIVVLEGASLETVKVGKTYELLNCDKHK SILLKNGRDPGEARPDITHQSLLMLMDSPLNRAGLLQVYIHTQKNVLIEVNPQTRIPRTFDRFCGLMVQL LHKLSVRAADGPQKLLKVIKNPVSDHFPVGCMKVGTSFSIPVVSDVRELVPSSDPIVFVVGAFAHGKVSV EYTEKMVSISNYPLSAALTCAKLTTAFEEVWGVI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006322 |
| RefSeq Size | 1072 |
| RefSeq ORF | 732 |
| Synonyms | C2F; Grcc2f; NEP1 |
| Locus ID | 10436 |
| Cytogenetics | 12p13.31 |
| Summary | This gene encodes an essential, conserved eukaryotic protein that methylates pseudouridine in 18S rRNA. The related protein in yeast is a component of the small subunit processome and is essential for biogenesis of the ribosomal 40S subunit. A mutation in this gene has been associated with Bowen-Conradi syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401906 | EMG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401906 | Transient overexpression lysate of EMG1 nucleolar protein homolog (S. cerevisiae) (EMG1) |
CNY 3080.00 |
|
| TP308885 | Recombinant protein of human EMG1 nucleolar protein homolog (S. cerevisiae) (EMG1), 20 µg |
CNY 2900.00 |
