Apolipoprotein CI (APOC1) (NM_001645) Human Mass Spec Standard
CAT#: PH308888
APOC1 MS Standard C13 and N15-labeled recombinant protein (NP_001636)
View other "Apolipoprotein CI" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
Specifications
| Product Data | |
| Description | APOC1 MS Standard C13 and N15-labeled recombinant protein (NP_001636) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC208888 | 
| Predicted MW | 9.3 kDa | 
| Protein Sequence | 
                 >RC208888 protein sequence 
Red=Cloning site Green=Tags(s) MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSE TFQKVKEKLKIDS myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_001636 | 
| RefSeq Size | 464 | 
| RefSeq ORF | 249 | 
| Synonyms | Apo-CI; apo-CIB; ApoC-I; apoC-IB | 
| Locus ID | 341 | 
| Cytogenetics | 19q13.32 | 
| Summary | This gene encodes a member of the apolipoprotein C1 family. This gene is expressed primarily in the liver, and it is activated when monocytes differentiate into macrophages. The encoded protein plays a central role in high density lipoprotein (HDL) and very low density lipoprotein (VLDL) metabolism. This protein has also been shown to inhibit cholesteryl ester transfer protein in plasma. A pseudogene of this gene is located 4 kb downstream in the same orientation, on the same chromosome. This gene is mapped to chromosome 19, where it resides within a apolipoprotein gene cluster. Alternative splicing and the use of alternative promoters results in multiple transcript variants. [provided by RefSeq, Sep 2016] | 
| Protein Families | Secreted Protein | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC419826 | APOC1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY419826 | Transient overexpression lysate of apolipoprotein C-I (APOC1) | 
                                                     CNY 3080.00  | 
                                            |
| TP308888 | Recombinant protein of human apolipoprotein C-I (APOC1), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
其它Apolipoprotein CI产品
