MRPS17 (NM_015969) Human Mass Spec Standard
CAT#: PH308911
MRPS17 MS Standard C13 and N15-labeled recombinant protein (NP_057053)
View other "MRPS17" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 3080.00
Specifications
Product Data | |
Description | MRPS17 MS Standard C13 and N15-labeled recombinant protein (NP_057053) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208911 |
Predicted MW | 14.5 kDa |
Protein Sequence |
>RC208911 protein sequence
Red=Cloning site Green=Tags(s) MSVVRSSVHARWIVGKVIGTKMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTVGDIVLLRALP VPRAKHVKHELAEIVFKVGKVIDPVTGKPCAGTTYLESPLSSETTQLSKNLEELNISSAQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057053 |
RefSeq Size | 600 |
RefSeq ORF | 390 |
Synonyms | HSPC011; MRP-S17; RPMS17; S17mt |
Locus ID | 51373 |
Cytogenetics | 7p11.2 |
Summary | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S17P family. The encoded protein is moderately conserved between human mitochondrial and prokaryotic ribosomal proteins. Pseudogenes corresponding to this gene are found on chromosomes 1p, 3p, 6q, 14p, 18q, and Xq. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414275 | MRPS17 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414275 | Transient overexpression lysate of mitochondrial ribosomal protein S17 (MRPS17), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
TP308911 | Recombinant protein of human mitochondrial ribosomal protein S17 (MRPS17), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2900.00 |