CSDC2 (NM_014460) Human Mass Spec Standard
CAT#: PH308989
CSDC2 MS Standard C13 and N15-labeled recombinant protein (NP_055275)
View other "CSDC2" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CSDC2 MS Standard C13 and N15-labeled recombinant protein (NP_055275) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208989 |
| Predicted MW | 16.8 kDa |
| Protein Sequence |
>RC208989 protein sequence
Red=Cloning site Green=Tags(s) MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFK GVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKMCPIPPKNQKFQAVEVVLTQLAPH TPHETWSGQVVGS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055275 |
| RefSeq Size | 2545 |
| RefSeq ORF | 459 |
| Synonyms | dJ347H13.2; PIPPIN |
| Locus ID | 27254 |
| Cytogenetics | 22q13.2 |
| Summary | RNA-binding factor which binds specifically to the very 3' UTR ends of both histone H1 and H3.3 mRNAs, encompassing the polyadenylation signal. Might play a central role in the negative regulation of histone variant synthesis in the developing brain (By similarity).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415263 | CSDC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415263 | Transient overexpression lysate of cold shock domain containing C2, RNA binding (CSDC2) |
CNY 3080.00 |
|
| TP308989 | Recombinant protein of human cold shock domain containing C2, RNA binding (CSDC2), 20 µg |
CNY 2900.00 |
|
| TP710146 | Recombinant protein of human cold shock domain containing C2, RNA binding (CSDC2), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |
