CSDC2 (NM_014460) Human Mass Spec Standard
CAT#: PH308989
CSDC2 MS Standard C13 and N15-labeled recombinant protein (NP_055275)
View other "CSDC2" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | CSDC2 MS Standard C13 and N15-labeled recombinant protein (NP_055275) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208989 |
Predicted MW | 16.8 kDa |
Protein Sequence |
>RC208989 protein sequence
Red=Cloning site Green=Tags(s) MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFK GVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKMCPIPPKNQKFQAVEVVLTQLAPH TPHETWSGQVVGS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055275 |
RefSeq Size | 2545 |
RefSeq ORF | 459 |
Synonyms | dJ347H13.2; PIPPIN |
Locus ID | 27254 |
Cytogenetics | 22q13.2 |
Summary | RNA-binding factor which binds specifically to the very 3' UTR ends of both histone H1 and H3.3 mRNAs, encompassing the polyadenylation signal. Might play a central role in the negative regulation of histone variant synthesis in the developing brain (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415263 | CSDC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415263 | Transient overexpression lysate of cold shock domain containing C2, RNA binding (CSDC2) |
CNY 3080.00 |
|
TP308989 | Recombinant protein of human cold shock domain containing C2, RNA binding (CSDC2), 20 µg |
CNY 2900.00 |
|
TP710146 | Recombinant protein of human cold shock domain containing C2, RNA binding (CSDC2), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |