LIS1 (PAFAH1B1) (NM_000430) Human Mass Spec Standard
CAT#: PH309055
PAFAH1B1 MS Standard C13 and N15-labeled recombinant protein (NP_000421)
View other "LIS1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | PAFAH1B1 MS Standard C13 and N15-labeled recombinant protein (NP_000421) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209055 |
Predicted MW | 46.5 kDa |
Protein Sequence |
>RC209055 representing NM_000430
Red=Cloning site Green=Tags(s) MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELES KLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETG DFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSA SRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVE CISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGG KFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000421 |
RefSeq Size | 5581 |
RefSeq ORF | 1230 |
Synonyms | LIS1; LIS2; MDCR; MDS; NudF; PAFAH |
Locus ID | 5048 |
Cytogenetics | 17p13.3 |
Summary | This locus was identified as encoding a gene that when mutated or lost caused the lissencephaly associated with Miller-Dieker lissencephaly syndrome. This gene encodes the non-catalytic alpha subunit of the intracellular Ib isoform of platelet-activating factor acteylhydrolase, a heterotrimeric enzyme that specifically catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine). Two other isoforms of intracellular platelet-activating factor acetylhydrolase exist: one composed of multiple subunits, the other, a single subunit. In addition, a single-subunit isoform of this enzyme is found in serum. [provided by RefSeq, Apr 2009] |
Protein Pathways | Ether lipid metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424722 | PAFAH1B1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424722 | Transient overexpression lysate of platelet-activating factor acetylhydrolase, isoform Ib, subunit 1 (45kDa) (PAFAH1B1) |
CNY 3080.00 |
|
TP309055 | Recombinant protein of human platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit 45kDa (PAFAH1B1), 20 µg |
CNY 2900.00 |