AKR1C2 (NM_205845) Human Mass Spec Standard
CAT#: PH309081
AKR1C2 MS Standard C13 and N15-labeled recombinant protein (NP_995317)
View other "AKR1C2" proteins (10)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | AKR1C2 MS Standard C13 and N15-labeled recombinant protein (NP_995317) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209081 |
| Predicted MW | 36.7 kDa |
| Protein Sequence |
>RC209081 protein sequence
Red=Cloning site Green=Tags(s) MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIA DGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFD TVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKD IVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQN VQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_995317 |
| RefSeq Size | 3521 |
| RefSeq ORF | 969 |
| Synonyms | AKR1C-pseudo; BABP; DD; DD-2; DD/BABP; DD2; DDH2; HAKRD; HBAB; MCDR2; SRXY8; TDD |
| Locus ID | 1646 |
| Cytogenetics | 10p15.1 |
| Summary | This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols using NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Dec 2011] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolism of xenobiotics by cytochrome P450 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400539 | AKR1C2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404270 | AKR1C2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427603 | AKR1C2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400539 | Transient overexpression lysate of aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) (AKR1C2), transcript variant 1 |
CNY 3080.00 |
|
| LY404270 | Transient overexpression lysate of aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) (AKR1C2), transcript variant 2 |
CNY 3080.00 |
|
| LY427603 | Transient overexpression lysate of aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) (AKR1C2), transcript variant 3 |
CNY 3080.00 |
|
| PH313538 | AKR1C2 MS Standard C13 and N15-labeled recombinant protein (NP_001345) |
CNY 19520.00 |
|
| TP309081 | Recombinant protein of human aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) (AKR1C2), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP313538 | Recombinant protein of human aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) (AKR1C2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP720265 | Recombinant protein of human similar to hCG2017792 (LOC100134257) |
CNY 1800.00 |
