DPH4 (DNAJC24) (NM_181706) Human Mass Spec Standard
CAT#: PH309088
DNAJC24 MS Standard C13 and N15-labeled recombinant protein (NP_859057)
View other "DPH4" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | DNAJC24 MS Standard C13 and N15-labeled recombinant protein (NP_859057) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209088 |
Predicted MW | 17 kDa |
Protein Sequence |
>RC209088 protein sequence
Red=Cloning site Green=Tags(s) MAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKILGN EETKREYDLQRCEDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSL IIELLHYN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_859057 |
RefSeq Size | 3000 |
RefSeq ORF | 444 |
Synonyms | DPH4; JJJ3; ZCSL3 |
Locus ID | 120526 |
Cytogenetics | 11p13 |
Summary | Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2; MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH4 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 [PubMed 15485916]).[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405653 | DNAJC24 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405653 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 24 (DNAJC24) |
CNY 3080.00 |
|
TP309088 | Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 24 (DNAJC24), 20 µg |
CNY 2900.00 |