PSMB5 (NM_002797) Human Mass Spec Standard
CAT#: PH309326
PSMB5 MS Standard C13 and N15-labeled recombinant protein (NP_002788)
View other "PSMB5" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | PSMB5 MS Standard C13 and N15-labeled recombinant protein (NP_002788) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209326 |
Predicted MW | 28.5 kDa |
Protein Sequence |
>RC209326 protein sequence
Red=Cloning site Green=Tags(s) MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGTTTLAFKFRHG VIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASK LLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQ AYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKYSGSTP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002788 |
RefSeq Size | 1311 |
RefSeq ORF | 789 |
Synonyms | LMPX; MB1; X |
Locus ID | 5693 |
Cytogenetics | 14q11.2 |
Summary | The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit in the proteasome. This catalytic subunit is not present in the immunoproteasome and is replaced by catalytic subunit 3i (proteasome beta 8 subunit). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2009] |
Protein Families | Protease |
Protein Pathways | Proteasome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400989 | PSMB5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427268 | PSMB5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400989 | Transient overexpression lysate of proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 1 |
CNY 3080.00 |
|
LY427268 | Transient overexpression lysate of proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 2 |
CNY 3080.00 |
|
TP309326 | Recombinant protein of human proteasome (prosome, macropain) subunit, beta type, 5 (PSMB5), transcript variant 1, 20 µg |
CNY 2900.00 |