ARL8B (NM_018184) Human Mass Spec Standard
CAT#: PH309368
ARL8B MS Standard C13 and N15-labeled recombinant protein (NP_060654)
View other "ARL8B" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
Specifications
| Product Data | |
| Description | ARL8B MS Standard C13 and N15-labeled recombinant protein (NP_060654) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC209368 | 
| Predicted MW | 21.5 kDa | 
| Protein Sequence | 
                 >RC209368 protein sequence 
Red=Cloning site Green=Tags(s) MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIW DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDE KQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_060654 | 
| RefSeq Size | 3008 | 
| RefSeq ORF | 558 | 
| Synonyms | ARL10C; Gie1 | 
| Locus ID | 55207 | 
| Cytogenetics | 3p26.1 | 
| Summary | Plays a role in lysosome motility (PubMed:16537643, PubMed:25898167). In neurons, mediates the anterograde axonal long-range transport of presynaptic lysosome-related vesicles required for presynaptic biogenesis and synaptic function (By similarity). May play a role in chromosome segregation (PubMed:15331635).[UniProtKB/Swiss-Prot Function] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC402654 | ARL8B HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY402654 | Transient overexpression lysate of ADP-ribosylation factor-like 8B (ARL8B) | 
                                                     CNY 3080.00  | 
                                            |
| TP309368 | Recombinant protein of human ADP-ribosylation factor-like 8B (ARL8B), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
