KK LC 1 (CT83) (NM_001017978) Human Mass Spec Standard
CAT#: PH309391
CXorf61 MS Standard C13 and N15-labeled recombinant protein (NP_001017978)
View other "KK LC 1" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | CXorf61 MS Standard C13 and N15-labeled recombinant protein (NP_001017978) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC209391 | 
| Predicted MW | 12.8 kDa | 
| Protein Sequence | 
                 >RC209391 protein sequence 
Red=Cloning site Green=Tags(s) MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNF PHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_001017978 | 
| RefSeq Size | 580 | 
| RefSeq ORF | 339 | 
| Synonyms | CXorf61; KK-LC-1; KKLC1 | 
| Locus ID | 203413 | 
| Cytogenetics | Xq23 | 
| Protein Families | Transmembrane | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC400409 | CT83 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY400409 | Transient overexpression lysate of chromosome X open reading frame 61 (CXorf61) | 
                                                     CNY 3080.00  | 
                                            |
| TP309391 | Recombinant protein of human chromosome X open reading frame 61 (CXorf61), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
其它KK LC 1产品
