RHOJ (NM_020663) Human Mass Spec Standard
CAT#: PH309395
RHOJ MS Standard C13 and N15-labeled recombinant protein (NP_065714)
View other "RHOJ" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | RHOJ MS Standard C13 and N15-labeled recombinant protein (NP_065714) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209395 |
| Predicted MW | 23.8 kDa |
| Protein Sequence |
>RC209395 protein sequence
Red=Cloning site Green=Tags(s) MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHL LGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDD PKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEGHSC CSII myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_065714 |
| RefSeq Size | 3619 |
| RefSeq ORF | 642 |
| Synonyms | ARHJ; RASL7B; TC10B; TCL |
| Locus ID | 57381 |
| Cytogenetics | 14q23.2 |
| Summary | This gene encodes one of the many small GTP-binding proteins in the Rho family shown to be associated with focal adhesions in endothelial cells (PMID: 21148427, 22103495). The encoded protein is activated by vascular endothelial growth factor and may regulate angiogenesis. [provided by RefSeq, Dec 2011] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412401 | RHOJ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412401 | Transient overexpression lysate of ras homolog gene family, member J (RHOJ) |
CNY 3080.00 |
|
| TP309395 | Recombinant protein of human ras homolog gene family, member J (RHOJ), 20 µg |
CNY 2900.00 |
