AMSH (STAMBP) (NM_006463) Human Mass Spec Standard
CAT#: PH309475
STAMBP MS Standard C13 and N15-labeled recombinant protein (NP_006454)
View other "AMSH" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | STAMBP MS Standard C13 and N15-labeled recombinant protein (NP_006454) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209475 |
Predicted MW | 48.1 kDa |
Protein Sequence |
>RC209475 protein sequence
Red=Cloning site Green=Tags(s) MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLF IEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQ ELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPT LTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVE TCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLH THCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTI TDLR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006454 |
RefSeq Size | 6386 |
RefSeq ORF | 1272 |
Synonyms | AMSH; MICCAP |
Locus ID | 10617 |
Cytogenetics | 2p13.1 |
Summary | Cytokine-mediated signal transduction in the JAK-STAT cascade requires the involvement of adaptor molecules. One such signal-transducing adaptor molecule contains an SH3 domain that is required for induction of MYC and cell growth. The protein encoded by this gene binds to the SH3 domain of the signal-transducing adaptor molecule, and plays a critical role in cytokine-mediated signaling for MYC induction and cell cycle progression. Multiple alternatively spliced transcript variants encoding the same protein isoform have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Endocytosis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403869 | STAMBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC404497 | STAMBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416628 | STAMBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403869 | Transient overexpression lysate of STAM binding protein (STAMBP), transcript variant 3 |
CNY 4840.00 |
|
LY404497 | Transient overexpression lysate of STAM binding protein (STAMBP), transcript variant 2 |
CNY 3080.00 |
|
LY416628 | Transient overexpression lysate of STAM binding protein (STAMBP), transcript variant 1 |
CNY 3080.00 |
|
PH301090 | STAMBP MS Standard C13 and N15-labeled recombinant protein (NP_964010) |
CNY 19520.00 |
|
PH317643 | STAMBP MS Standard C13 and N15-labeled recombinant protein (NP_998787) |
CNY 19520.00 |
|
TP301090 | Recombinant protein of human STAM binding protein (STAMBP), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP309475 | Recombinant protein of human STAM binding protein (STAMBP), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP317643 | Recombinant protein of human STAM binding protein (STAMBP), transcript variant 3, 20 µg |
CNY 2900.00 |