ASB7 (NM_024708) Human Mass Spec Standard
CAT#: PH309502
ASB7 MS Standard C13 and N15-labeled recombinant protein (NP_078984)
View other "ASB7" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | ASB7 MS Standard C13 and N15-labeled recombinant protein (NP_078984) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209502 |
Predicted MW | 30.7 kDa |
Protein Sequence |
>RC209502 protein sequence
Red=Cloning site Green=Tags(s) MLHHHCRRNPELQEELQIQAAVAAGDVHTVRKMLEQGYSPNGRDANGWTLLHFSAARGKERCVRVFLEHG ADPTVKDLIGGFTALHYAAMHGRARIARLMLESEYRSDIINAKSNDGWTPLHVAAHYGRDSFVRLLLEFK AEVDPLSDKGTTPLQLAIIRERSSCVKILLDHNANIDIQNGFLLRYAVIKSNHSYCRMFLQRGADTNLGR LEDGQTPLHLSALRDDVLCARMLYNYGADTNTRNYEGQTPLAVSISISGSSRPCLDFLQEVTSM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_078984 |
RefSeq Size | 1769 |
RefSeq ORF | 822 |
Locus ID | 140460 |
Cytogenetics | 15q26.3 |
Summary | The protein encoded by this gene belongs to a family of ankyrin repeat proteins that, along with four other protein families, contains a C-terminal SOCS box motif. Growing evidence suggests that the SOCS box acts as a bridge between specific substrate-binding domains and the more generic proteins that comprise a large family of E3 ubiquitin protein ligases. In this way, SOCS box containing proteins may regulate protein turnover by targeting proteins for polyubiquination and, therefore, for proteasome-mediated degradation. Two alternative transcripts encoding different isoforms have been described. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404964 | ASB7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC411164 | ASB7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404964 | Transient overexpression lysate of ankyrin repeat and SOCS box-containing 7 (ASB7), transcript variant 2 |
CNY 3080.00 |
|
LY411164 | Transient overexpression lysate of ankyrin repeat and SOCS box-containing 7 (ASB7), transcript variant 1 |
CNY 3080.00 |
|
TP309502 | Recombinant protein of human ankyrin repeat and SOCS box-containing 7 (ASB7), transcript variant 1, 20 µg |
CNY 2900.00 |