Lactate Dehydrogenase C (LDHC) (NM_002301) Human Mass Spec Standard
CAT#: PH309516
LDHC MS Standard C13 and N15-labeled recombinant protein (NP_002292)
View other "Lactate Dehydrogenase C" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | LDHC MS Standard C13 and N15-labeled recombinant protein (NP_002292) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209516 |
| Predicted MW | 36.1 kDa |
| Protein Sequence |
>RC209516 representing NM_002301
Red=Cloning site Green=Tags(s) MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSL FFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV DILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVA LKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGL YGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002292 |
| RefSeq Size | 1278 |
| RefSeq ORF | 996 |
| Synonyms | CT32; LDH3; LDHX |
| Locus ID | 3948 |
| Cytogenetics | 11p15.1 |
| Summary | Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family. Two transcript variants have been detected which differ in the 5' untranslated region. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Cysteine and methionine metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Propanoate metabolism, Pyruvate metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400837 | LDHC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC413747 | LDHC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400837 | Transient overexpression lysate of lactate dehydrogenase C (LDHC), transcript variant 1 |
CNY 3080.00 |
|
| LY413747 | Transient overexpression lysate of lactate dehydrogenase C (LDHC), transcript variant 2 |
CNY 3080.00 |
|
| PH310627 | LDHC MS Standard C13 and N15-labeled recombinant protein (NP_059144) |
CNY 19520.00 |
|
| TP309516 | Recombinant protein of human lactate dehydrogenase C (LDHC), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP310627 | Recombinant protein of human lactate dehydrogenase C (LDHC), transcript variant 2, 20 µg |
CNY 2900.00 |
其它Lactate Dehydrogenase C产品


