ELK4 (NM_021795) Human Mass Spec Standard
CAT#: PH309572
ELK4 MS Standard C13 and N15-labeled recombinant protein (NP_068567)
View other "ELK4" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | ELK4 MS Standard C13 and N15-labeled recombinant protein (NP_068567) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209572 |
Predicted MW | 44.7 kDa |
Protein Sequence |
>RC209572 protein sequence
Red=Cloning site Green=Tags(s) MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVKN IIKKVNGQKFVYKFVSYPEILNMDPMTVGRIEGDCESLNFSEVSSSSKDVENGGKDKPPQPGAKTSSRND YIHSGLYSSFTLNSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPPVEPVAATISI GPSISPSSEETIQALETLVSPKLPSLEAPTSASNVMTAFATTPPISSIPPLQEPPRTPSPPLSSHPDIDT DIDSVASQPMELPENLSLEPKDQDSVLLEKDKVNNSSRSKKPKGLELAPTLVITSSDPSPLGILSPSLPT ASLTPAFFSQVACSLFMVSPLLSFICPFKQIQNLYTQVCFLLLRFVLERLCVTVM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_068567 |
RefSeq Size | 3077 |
RefSeq ORF | 1215 |
Synonyms | SAP1 |
Locus ID | 2005 |
Cytogenetics | 1q32.1 |
Summary | This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is phosphorylated by the kinases, MAPK1 and MAPK8. Several transcript variants have been described for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | MAPK signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411912 | ELK4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419619 | ELK4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY411912 | Transient overexpression lysate of ELK4, ETS-domain protein (SRF accessory protein 1) (ELK4), transcript variant b |
CNY 3080.00 |
|
LY419619 | Transient overexpression lysate of ELK4, ETS-domain protein (SRF accessory protein 1) (ELK4), transcript variant a |
CNY 4840.00 |
|
TP309572 | Recombinant protein of human ELK4, ETS-domain protein (SRF accessory protein 1) (ELK4), transcript variant b, 20 µg |
CNY 2900.00 |
|
TP760364 | Purified recombinant protein of Human ELK4, ETS-domain protein (SRF accessory protein 1) (ELK4), transcript variant a, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |