OTUB2 (NM_023112) Human Mass Spec Standard
CAT#: PH309650
OTUB2 MS Standard C13 and N15-labeled recombinant protein (NP_075601)
View other "OTUB2" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | OTUB2 MS Standard C13 and N15-labeled recombinant protein (NP_075601) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209650 |
| Predicted MW | 27.2 kDa |
| Protein Sequence |
>RC209650 protein sequence
Red=Cloning site Green=Tags(s) MSETSFNLISEKCDILSILRDHPENRIYRRKIEELSKRFTAIRKTKGDGNCFYRALGYSYLESLLGKSRE IFKFKERVLQTPNDLLAAGFEEHKFRNFFNAFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTS AFIRNRADFFRHFIDEEMDIKDFCTHEVEPMATECDHIQITALSQALSIALQVEYVDEMDTALNHHVFPE AATPSVYLLYKTSHYNILYAADKH SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_075601 |
| RefSeq Size | 3873 |
| RefSeq ORF | 702 |
| Synonyms | C14orf137; OTB2; OTU2 |
| Locus ID | 78990 |
| Cytogenetics | 14q32.12 |
| Summary | This gene encodes one of several deubiquitylating enzymes. Ubiquitin modification of proteins is needed for their stability and function; to reverse the process, deubiquityling enzymes remove ubiquitin. This protein contains an OTU domain and binds Ubal (ubiquitin aldehyde); an active cysteine protease site is present in the OTU domain. [provided by RefSeq, Aug 2011] |
| Protein Families | Protease |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402958 | OTUB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402958 | Transient overexpression lysate of OTU domain, ubiquitin aldehyde binding 2 (OTUB2) |
CNY 3080.00 |
|
| TP309650 | Recombinant protein of human OTU domain, ubiquitin aldehyde binding 2 (OTUB2), 20 µg |
CNY 2900.00 |
|
| TP720215 | Recombinant protein of human OTU domain, ubiquitin aldehyde binding 2 (OTUB2) |
CNY 1800.00 |
