Galectin 13 (LGALS13) (NM_013268) Human Mass Spec Standard
CAT#: PH309738
LGALS13 MS Standard C13 and N15-labeled recombinant protein (NP_037400)
View other "Galectin 13" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | LGALS13 MS Standard C13 and N15-labeled recombinant protein (NP_037400) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209738 |
| Predicted MW | 16.1 kDa |
| Protein Sequence |
>RC209738 protein sequence
Red=Cloning site Green=Tags(s) MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFG IWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_037400 |
| RefSeq Size | 610 |
| RefSeq ORF | 417 |
| Synonyms | GAL13; PLAC8; PP13 |
| Locus ID | 29124 |
| Cytogenetics | 19q13.2 |
| Summary | Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene has lysophospholipase activity. It is composed of two identical subunits which are held together by disulfide bonds. This protein has structural similarity to several members of the beta-galactoside-binding S-type lectin family. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415702 | LGALS13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415702 | Transient overexpression lysate of lectin, galactoside-binding, soluble, 13 (LGALS13) |
CNY 3080.00 |
|
| TP309738 | Recombinant protein of human lectin, galactoside-binding, soluble, 13 (LGALS13), 20 µg |
CNY 2900.00 |
其它Galectin 13产品
