Proteasome subunit alpha type 6 (PSMA6) (NM_002791) Human Mass Spec Standard
CAT#: PH309976
PSMA6 MS Standard C13 and N15-labeled recombinant protein (NP_002782)
View other "Proteasome subunit alpha type 6" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
CNY 3080.00
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
Specifications
| Product Data | |
| Description | PSMA6 MS Standard C13 and N15-labeled recombinant protein (NP_002782) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC209976 | 
| Predicted MW | 27.4 kDa | 
| Protein Sequence | 
                 >RC209976 protein sequence 
Red=Cloning site Green=Tags(s) MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLF KITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMIL IGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDF KPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_002782 | 
| RefSeq Size | 1091 | 
| RefSeq ORF | 738 | 
| Synonyms | IOTA; p27K; PROS27 | 
| Locus ID | 5687 | 
| Cytogenetics | 14q13.2 | 
| Summary | The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Multiple transcript variants encoding several different isoforms have been found for this gene. A pseudogene has been identified on the Y chromosome. [provided by RefSeq, Aug 2013] | 
| Protein Families | Druggable Genome, Protease, Stem cell - Pluripotency | 
| Protein Pathways | Proteasome | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC419119 | PSMA6 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY419119 | Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 6 (PSMA6) | 
                                                     CNY 3080.00  | 
                                            |
| TP309976 | Recombinant protein of human proteasome (prosome, macropain) subunit, alpha type, 6 (PSMA6), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
其它Proteasome subunit alpha type 6产品
