Interferon gamma (IFNG) (NM_000619) Human Mass Spec Standard
CAT＃: PH309993
IFNG MS Standard C13 and N15-labeled recombinant protein (NP_000610)
View other "Interferon gamma" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Product images
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | IFNG MS Standard C13 and N15-labeled recombinant protein (NP_000610) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209993 |
| Predicted MW | 19.3 kDa |
| Protein Sequence |
>RC209993 protein sequence
Red=Cloning site Green=Tags(s) MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQS QIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVM AELSPAAKTGKRKRSQMLFRGRRASQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000610 |
| RefSeq Size | 1240 |
| RefSeq ORF | 498 |
| Synonyms | IFG; IFI; IMD69 |
| Locus ID | 3458 |
| Cytogenetics | 12q15 |
| Summary | This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. Mutations in this gene are associated with an increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases. [provided by RefSeq, Dec 2015] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Allograft rejection, Cytokine-cytokine receptor interaction, Graft-versus-host disease, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Proteasome, Regulation of autophagy, Systemic lupus erythematosus, T cell receptor signaling pathway, TGF-beta signaling pathway, Type I diabetes mellitus |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400207 | IFNG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400207 | Transient overexpression lysate of interferon, gamma (IFNG) |
CNY 3080.00 |
|
| TP309993 | Purified recombinant protein of Homo sapiens interferon, gamma (IFNG), 20 µg |
CNY 2900.00 |
|
| TP720013 | Recombinant protein of human interferon, gamma (IFNG) |
CNY 1800.00 |
|
| TP721239 | Purified recombinant protein of Human interferon, gamma (IFNG) |
CNY 1800.00 |
|
| TP723709 | Purified recombinant protein of Human interferon, gamma (IFNG) |
CNY 3120.00 |
|
| TP760490 | Purified recombinant protein of Human interferon, gamma (IFNG), with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
其它Interferon gamma产品
Purified recombinant protein of Human interferon, gamma (IFNG), with N-terminal HIS tag, expressed in E.Coli, 50ug
