TSC22D3 (NM_004089) Human Mass Spec Standard
CAT#: PH310088
TSC22D3 MS Standard C13 and N15-labeled recombinant protein (NP_004080)
View other "TSC22D3" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
CNY 3080.00
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
Specifications
| Product Data | |
| Description | TSC22D3 MS Standard C13 and N15-labeled recombinant protein (NP_004080) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC210088 | 
| Predicted MW | 14.8 kDa | 
| Protein Sequence | 
                 >RC210088 protein sequence 
Red=Cloning site Green=Tags(s) MNTEMYQTPMEVAVYQLHNFSISFFSSLLGGDVVSVKLDNSASGASVVAIDNKIEQAMDLVKNHLMYAVR EEVEILKEQIRELVEKNSQLERENTLLKTLASPEQLEKFQSCLSPEEPAPESPQVPEAPGGSAV myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_004080 | 
| RefSeq Size | 1986 | 
| RefSeq ORF | 402 | 
| Synonyms | DIP; DSIPI; GILZ; TSC-22R | 
| Locus ID | 1831 | 
| Cytogenetics | Xq22.3 | 
| Summary | This gene encodes the anti-inflammatory protein glucocorticoid (GC)-induced leucine zipper. Expression of this gene stimulated by glucocorticoids and interleukin 10 and it appears to play a key role in the anti-inflammatory and immunosuppressive effects of this steroid. This protein has also been shown to inhibit pro-inflammatory molecules including nuclear factor κB. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016] | 
| Protein Families | Transcription Factors | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC418232 | TSC22D3 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY418232 | Transient overexpression lysate of TSC22 domain family, member 3 (TSC22D3), transcript variant 2 | 
                                                     CNY 3080.00  | 
                                            |
| TP310088 | Recombinant protein of human TSC22 domain family, member 3 (TSC22D3), transcript variant 2, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
其它TSC22D3产品
