FGF 23 (FGF23) (NM_020638) Human Mass Spec Standard
CAT#: PH310127
FGF23 MS Standard C13 and N15-labeled recombinant protein (NP_065689)
View other "FGF 23" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 4070.00
Specifications
| Product Data | |
| Description | FGF23 MS Standard C13 and N15-labeled recombinant protein (NP_065689) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210127 |
| Predicted MW | 28 kDa |
| Protein Sequence |
>RC210127 protein sequence
Red=Cloning site Green=Tags(s) MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIY SALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGR AKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQEL PSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_065689 |
| RefSeq Size | 3018 |
| RefSeq ORF | 753 |
| Synonyms | ADHR; FGFN; HFTC2; HPDR2; HYPF; PHPTC |
| Locus ID | 8074 |
| Cytogenetics | 12p13.32 |
| Summary | This gene encodes a member of the fibroblast growth factor family of proteins, which possess broad mitogenic and cell survival activities and are involved in a variety of biological processes. The product of this gene regulates phosphate homeostasis and transport in the kidney. The full-length, functional protein may be deactivated via cleavage into N-terminal and C-terminal chains. Mutation of this cleavage site causes autosomal dominant hypophosphatemic rickets (ADHR). Mutations in this gene are also associated with hyperphosphatemic familial tumoral calcinosis (HFTC). [provided by RefSeq, Feb 2013] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412413 | FGF23 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412413 | Transient overexpression lysate of fibroblast growth factor 23 (FGF23) |
CNY 3080.00 |
|
| TP310127 | Recombinant protein of human fibroblast growth factor 23 (FGF23), 20 µg |
CNY 2900.00 |
|
| TP750171 | Purified recombinant protein of Rabbit FGF23, full length, with C-terminal myc-DDK tag, expressed in E.coli, 50ug |
CNY 1948.00 |
