RGS8 (NM_033345) Human Mass Spec Standard
CAT#: PH310236
RGS8 MS Standard C13 and N15-labeled recombinant protein (NP_203131)
View other "RGS8" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | RGS8 MS Standard C13 and N15-labeled recombinant protein (NP_203131) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210236 |
Predicted MW | 23 kDa |
Protein Sequence |
>RC210236 protein sequence
Red=Cloning site Green=Tags(s) MWNTLTRSLSDHPVGKDPQAMRTGQRQNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATR WADSFDVLLSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPREVN IDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLSQSQRRLS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_203131 |
RefSeq Size | 783 |
RefSeq ORF | 594 |
Locus ID | 85397 |
Cytogenetics | 1q25.3 |
Summary | This gene is a member of the regulator of G protein signaling (RGS) family and encodes a protein with a single RGS domain. Regulator of G protein signaling (RGS) proteins are regulatory and structural components of G protein-coupled receptor complexes. They accelerate transit through the cycle of GTP binding and hydrolysis to GDP, thereby terminating signal transduction, but paradoxically, also accelerate receptor-stimulated activation. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409583 | RGS8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420151 | RGS8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409583 | Transient overexpression lysate of regulator of G-protein signaling 8 (RGS8), transcript variant 1 |
CNY 3080.00 |
|
LY420151 | Transient overexpression lysate of regulator of G-protein signaling 8 (RGS8), transcript variant 2 |
CNY 3080.00 |
|
TP310236 | Recombinant protein of human regulator of G-protein signaling 8 (RGS8), transcript variant 1, 20 µg |
CNY 2900.00 |