SLC10A1 (NM_003049) Human Mass Spec Standard
CAT#: PH310241
SLC10A1 MS Standard C13 and N15-labeled recombinant protein (NP_003040)
View other "SLC10A1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | SLC10A1 MS Standard C13 and N15-labeled recombinant protein (NP_003040) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210241 |
Predicted MW | 37.9 kDa |
Protein Sequence |
>RC210241 representing NM_003049
Red=Cloning site Green=Tags(s) MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYG IMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYI YSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINV GKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIG PLFFFPLLYMIFQLGEGLLLIAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003040 |
RefSeq Size | 1580 |
RefSeq ORF | 1047 |
Synonyms | FHCA2; NTCP |
Locus ID | 6554 |
Cytogenetics | 14q24.1 |
Summary | The protein encoded by this gene belongs to the sodium/bile acid cotransporter family, which are integral membrane glycoproteins that participate in the enterohepatic circulation of bile acids. Two homologous transporters are involved in the reabsorption of bile acids; the ileal sodium/bile acid cotransporter with an apical cell localization that absorbs bile acids from the intestinal lumen, bile duct and kidney, and the liver-specific sodium/bile acid cotransporter, represented by this protein, that is found in the basolateral membranes of hepatocytes. Bile acids are the catabolic product of cholesterol metabolism, hence this protein is important for cholesterol homeostasis. [provided by RefSeq, Oct 2011] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418929 | SLC10A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418929 | Transient overexpression lysate of solute carrier family 10 (sodium/bile acid cotransporter family), member 1 (SLC10A1) |
CNY 3080.00 |
|
TP310241 | Purified recombinant protein of Homo sapiens solute carrier family 10 (sodium/bile acid cotransporter family), member 1 (SLC10A1), 20 µg |
CNY 2900.00 |
其它SLC10A1产品