ARL4C (NM_005737) Human Mass Spec Standard
CAT#: PH310286
ARL4C MS Standard C13 and N15-labeled recombinant protein (NP_005728)
View other "ARL4C" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ARL4C MS Standard C13 and N15-labeled recombinant protein (NP_005728) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210286 |
| Predicted MW | 21.5 kDa |
| Protein Sequence |
>RC210286 protein sequence
Red=Cloning site Green=Tags(s) MGNISSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVG GQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEI EKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQKKKR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005728 |
| RefSeq Size | 4024 |
| RefSeq ORF | 576 |
| Synonyms | ARL7; LAK |
| Locus ID | 10123 |
| Cytogenetics | 2q37.1 |
| Summary | ADP-ribosylation factor-like 4C is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4C is closely similar to ARL4A and ARL4D and each has a nuclear localization signal and an unusually high guanine nucleotide exchange rate. This protein may play a role in cholesterol transport. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417097 | ARL4C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417097 | Transient overexpression lysate of ADP-ribosylation factor-like 4C (ARL4C) |
CNY 3080.00 |
|
| TP310286 | Recombinant protein of human ADP-ribosylation factor-like 4C (ARL4C), 20 µg |
CNY 2900.00 |
