GNA11 (NM_002067) Human Mass Spec Standard
CAT#: PH310292
GNA11 MS Standard C13 and N15-labeled recombinant protein (NP_002058)
View other "GNA11" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | GNA11 MS Standard C13 and N15-labeled recombinant protein (NP_002058) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210292 |
| Predicted MW | 42.1 kDa |
| Protein Sequence |
>RC210292 protein sequence
Red=Cloning site Green=Tags(s) MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGAGYSEE DKRGFTKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANALLIREVDVEKVTTFEHQYVSAIKTLWEDPG IQECYDRRREYQLSDSAKYYLTDVDRIATLGYLPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQR SERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLE DKILYSHLVDYFPEFDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQ LNLKEYNLV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002058 |
| RefSeq Size | 4145 |
| RefSeq ORF | 1077 |
| Synonyms | FBH; FBH2; FHH2; GNA-11; HHC2; HYPOC2 |
| Locus ID | 2767 |
| Cytogenetics | 19p13.3 |
| Summary | The protein encoded by this gene belongs to the family of guanine nucleotide-binding proteins (G proteins), which function as modulators or transducers in various transmembrane signaling systems. G proteins are composed of 3 units: alpha, beta and gamma. This gene encodes one of the alpha subunits (subunit alpha-11). Mutations in this gene have been associated with hypocalciuric hypercalcemia type II (HHC2) and hypocalcemia dominant 2 (HYPOC2). Patients with HHC2 and HYPOC2 exhibit decreased or increased sensitivity, respectively, to changes in extracellular calcium concentrations. [provided by RefSeq, Dec 2013] |
| Protein Pathways | Calcium signaling pathway, Gap junction, GnRH signaling pathway, Long-term depression, Vascular smooth muscle contraction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419559 | GNA11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419559 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), alpha 11 (Gq class) (GNA11) |
CNY 3080.00 |
|
| TP310292 | Recombinant protein of human guanine nucleotide binding protein (G protein), alpha 11 (Gq class) (GNA11), 20 µg |
CNY 2900.00 |
