FNTA (NM_002027) Human Mass Spec Standard
CAT#: PH310293
FNTA MS Standard C13 and N15-labeled recombinant protein (NP_002018)
View other "FNTA" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | FNTA MS Standard C13 and N15-labeled recombinant protein (NP_002018) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210293 |
| Predicted MW | 44.4 kDa |
| Protein Sequence |
>RC210293 protein sequence
Red=Cloning site Green=Tags(s) MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDSPSYVLYRDRA EWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVL LKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVI QEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYL KGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDT IRKEYWRYIGRSLQSKHSTENDSPTNVQQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002018 |
| RefSeq Size | 1710 |
| RefSeq ORF | 1137 |
| Synonyms | FPTA; PGGT1A; PTAR2 |
| Locus ID | 2339 |
| Cytogenetics | 8p11.21 |
| Summary | Prenyltransferases can attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of proteins with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share the same alpha subunit but have different beta subunits. This gene encodes the alpha subunit of these transferases. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 11 and 13. [provided by RefSeq, May 2010] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419578 | FNTA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419578 | Transient overexpression lysate of farnesyltransferase, CAAX box, alpha (FNTA), transcript variant 1 |
CNY 3080.00 |
|
| TP310293 | Purified recombinant protein of Homo sapiens farnesyltransferase, CAAX box, alpha (FNTA), transcript variant 1, 20 µg |
CNY 2900.00 |
