CD226 (NM_006566) Human Mass Spec Standard
CAT#: PH310437
CD226 MS Standard C13 and N15-labeled recombinant protein (NP_006557)
View other "CD226" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CD226 MS Standard C13 and N15-labeled recombinant protein (NP_006557) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210437 |
| Predicted MW | 38.6 kDa |
| Protein Sequence |
>RC210437 protein sequence
Red=Cloning site Green=Tags(s) MDYPTLLLALLHVYRALCEEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMV IRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHI VSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIP DVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNQYTLFVAGGTVLLLLFVISITTIIVIFLNRRRR RERRDLFTESWDTQKAPNNYRSPISTGQPTNQSMDDTREDIYVNYPTFSRRPKTRV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006557 |
| RefSeq Size | 2664 |
| RefSeq ORF | 1008 |
| Synonyms | DNAM-1; DNAM1; PTA1; TLiSA1 |
| Locus ID | 10666 |
| Cytogenetics | 18q22.2 |
| Summary | This gene encodes a glycoprotein expressed on the surface of NK cells, platelets, monocytes and a subset of T cells. It is a member of the Ig-superfamily containing 2 Ig-like domains of the V-set. The protein mediates cellular adhesion of platelets and megakaryocytic cells to vascular endothelial cells. The protein also plays a role in megakaryocytic cell maturation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2015] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Cell adhesion molecules (CAMs) |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416555 | CD226 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416555 | Transient overexpression lysate of CD226 molecule (CD226) |
CNY 3080.00 |
|
| TP310437 | Recombinant protein of human CD226 molecule (CD226), 20 µg |
CNY 2900.00 |
|
| TP701017 | Purified recombinant protein of Human CD226 molecule (CD226), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug |
CNY 7106.00 |
|
| TP723967 | Human DNAM-1 Protein, mFc-His Tag |
CNY 5876.00 |
