MRPL39 (NM_017446) Human Mass Spec Standard
CAT#: PH310449
MRPL39 MS Standard C13 and N15-labeled recombinant protein (NP_059142)
View other "MRPL39" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | MRPL39 MS Standard C13 and N15-labeled recombinant protein (NP_059142) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210449 |
| Predicted MW | 38.7 kDa |
| Protein Sequence |
>RC210449 protein sequence
Red=Cloning site Green=Tags(s) MEALAMGSRALRLWLVAPGGGIKWRFIATSPASQLSPTELTEMRNDLFNKEKARQLSLTPRTEKIEVKHV GKTDPGTVFVMNKNISTPYSCAMHLSEWYCRKSILALVDGQPWDMYKPLTKSCEIKFLTFKDCDPGEVNK AYWRSCAMMMGCVIERAFKDEYMVNLVRAPEVPVISGAFCYDVVLDSKLDEWMPTKENLRSFTKDAHALI YKDLPFETLEVEAKVALEIFQHSKYKVDFIEEKASQNPERIVKLHRIGDFIDVSEGPLIPRTSICFQYEV SAVHNLQPTQPSLIRRFQGVSLPVHLRAHFTIWDKLLERSRKMVTEDQSKATEECTST myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_059142 |
| RefSeq Size | 1082 |
| RefSeq ORF | 1014 |
| Synonyms | C21orf92; L5mt; L39mt; MRP-L5; MRPL5; MSTP003; PRED22; PRED66; RPML5 |
| Locus ID | 54148 |
| Cytogenetics | 21q21.3 |
| Summary | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Two transcript variants encoding distinct isoforms have been described. A pseudogene corresponding to this gene is found on chromosome 5q. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413745 | MRPL39 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413745 | Transient overexpression lysate of mitochondrial ribosomal protein L39 (MRPL39), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
| TP310449 | Recombinant protein of human mitochondrial ribosomal protein L39 (MRPL39), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2900.00 |
