LBH (NM_030915) Human Mass Spec Standard
CAT#: PH310467
LBH MS Standard C13 and N15-labeled recombinant protein (NP_112177)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | LBH MS Standard C13 and N15-labeled recombinant protein (NP_112177) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210467 |
| Predicted MW | 12.2 kDa |
| Protein Sequence |
>RC210467 protein sequence
Red=Cloning site Green=Tags(s) MSIYFPIHCPDYLRSAKMTEVMMNTQPMEEIGLSPRKDGLSYQIFPDPSDFDRCCKLKDRLPSIVVEPTE GEVESGELRWPPEEFLVQEDEQDNCEETAKENKEQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_112177 |
| RefSeq Size | 2956 |
| RefSeq ORF | 315 |
| Locus ID | 81606 |
| Cytogenetics | 2p23.1 |
| Summary | Transcriptional activator which may act in mitogen-activated protein kinase signaling pathway.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403092 | LBH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403092 | Transient overexpression lysate of limb bud and heart development homolog (mouse) (LBH) |
CNY 3080.00 |
|
| TP310467 | Recombinant protein of human limb bud and heart development homolog (mouse) (LBH), 20 µg |
CNY 2900.00 |


