CAPZB (NM_004930) Human Mass Spec Standard
CAT#: PH310480
CAPZB MS Standard C13 and N15-labeled recombinant protein (NP_004921)
View other "CAPZB" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CAPZB MS Standard C13 and N15-labeled recombinant protein (NP_004921) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210480 |
| Predicted MW | 30.4 kDa |
| Protein Sequence |
>RC210480 representing NM_004930
Red=Cloning site Green=Tags(s) MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDS YRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDG SKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHI ANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004921 |
| RefSeq Size | 1647 |
| RefSeq ORF | 816 |
| Synonyms | CAPB; CAPPB; CAPZ |
| Locus ID | 832 |
| Cytogenetics | 1p36.13 |
| Summary | This gene encodes the beta subunit of the barbed-end actin binding protein, which belongs to the F-actin capping protein family. The capping protein is a heterodimeric actin capping protein that blocks actin filament assembly and disassembly at the fast growing (barbed) filament ends and functions in regulating actin filament dynamics as well as in stabilizing actin filament lengths in muscle and nonmuscle cells. A pseudogene of this gene is located on the long arm of chromosome 2. Multiple alternatively spliced transcript variants encoding different isoforms have been found.[provided by RefSeq, Aug 2013] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417647 | CAPZB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417647 | Transient overexpression lysate of capping protein (actin filament) muscle Z-line, beta (CAPZB) |
CNY 3080.00 |
|
| TP310480 | Recombinant protein of human capping protein (actin filament) muscle Z-line, beta (CAPZB), 20 µg |
CNY 2900.00 |
