CGRP (CALCB) (NM_000728) Human Mass Spec Standard
CAT#: PH310496
CALCB MS Standard C13 and N15-labeled recombinant protein (NP_000719)
View other "CGRP" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CALCB MS Standard C13 and N15-labeled recombinant protein (NP_000719) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210496 |
| Predicted MW | 13.7 kDa |
| Protein Sequence |
>RC210496 protein sequence
Red=Cloning site Green=Tags(s) MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQE TQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGRRRRDLQA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000719 |
| RefSeq Size | 1031 |
| RefSeq ORF | 381 |
| Synonyms | CALC2; CGRP-II; CGRP2 |
| Locus ID | 797 |
| Cytogenetics | 11p15.2 |
| Summary | CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424540 | CALCB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424540 | Transient overexpression lysate of calcitonin-related polypeptide beta (CALCB) |
CNY 3080.00 |
|
| TP310496 | Recombinant protein of human calcitonin-related polypeptide beta (CALCB), 20 µg |
CNY 2900.00 |
|
| TP721150 | Purified recombinant protein of Human calcitonin-related polypeptide beta (CALCB) |
CNY 1800.00 |
