ER81 (ETV1) (NM_004956) Human Mass Spec Standard
CAT#: PH310533
ETV1 MS Standard C13 and N15-labeled recombinant protein (NP_004947)
View other "ER81" proteins (11)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
Specifications
| Product Data | |
| Description | ETV1 MS Standard C13 and N15-labeled recombinant protein (NP_004947) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC210533 | 
| Predicted MW | 55.1 kDa | 
| Protein Sequence | 
                 >RC210533 protein sequence 
Red=Cloning site Green=Tags(s) MDGFYDQQVPYMVTNSQRGRNCNEKPTNVRKRKFINRDLAHDSEELFQDLSQLQETWLAEAQVPDNDEQF VPDYQAESLAFHGLPLKIKKEPHSPCSEISSACSQEQPFKFSYGEKCLYNVSAYDQKPQVGMRPSNPPTP SSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPLPTMPREGRPM YQRQMSEPNIPFPPQGFKQEYHDPVYEHNTMVGSAASQSFPPPLMIKQEPRDFAYDSEVPSCHSIYMRQE GFLAHPSRTEGCMFEKGPRQFYDDTCVVPEKFDGDIKQEPGMYREGPTYQRRGSLQLWQFLVALLDDPSN SHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEA LFSMAFPDNQRPLLKTDMERHINEEDTVPLSHFDESMAYMPEGGCCNPHPYNEGYVY myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_004947 | 
| RefSeq Size | 6824 | 
| RefSeq ORF | 1431 | 
| Synonyms | ER81 | 
| Locus ID | 2115 | 
| Cytogenetics | 7p21.2 | 
| Summary | This gene encodes a member of the ETS (E twenty-six) family of transcription factors. The ETS proteins regulate many target genes that modulate biological processes like cell growth, angiogenesis, migration, proliferation and differentiation. All ETS proteins contain an ETS DNA-binding domain that binds to DNA sequences containing the consensus 5'-CGGA[AT]-3'. The protein encoded by this gene contains a conserved short acidic transactivation domain (TAD) in the N-terminal region, in addition to the ETS DNA-binding domain in the C-terminal region. This gene is involved in chromosomal translocations, which result in multiple fusion proteins including EWS-ETV1 in Ewing sarcoma and at least 10 ETV1 partners (see PMID: 19657377, Table 1) in prostate cancer. In addition to chromosomal rearrangement, this gene is overexpressed in prostate cancer, melanoma and gastrointestinal stromal tumor. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2016] | 
| Protein Families | ES Cell Differentiation/IPS, Transcription Factors | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC401540 | ETV1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC431330 | ETV1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC431362 | ETV1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC431376 | ETV1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC431397 | ETV1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY401540 | Transient overexpression lysate of ets variant 1 (ETV1), transcript variant 1 | 
                                                     CNY 3080.00  | 
                                            |
| LY431330 | Transient overexpression lysate of ets variant 1 (ETV1), transcript variant 7 | 
                                                     CNY 3080.00  | 
                                            |
| LY431362 | Transient overexpression lysate of ets variant 1 (ETV1), transcript variant 6 | 
                                                     CNY 3080.00  | 
                                            |
| LY431376 | Transient overexpression lysate of ets variant 1 (ETV1), transcript variant 5 | 
                                                     CNY 3080.00  | 
                                            |
| LY431397 | Transient overexpression lysate of ets variant 1 (ETV1), transcript variant 2 | 
                                                     CNY 3080.00  | 
                                            |
| TP310533 | Recombinant protein of human ets variant 1 (ETV1), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
