PLSCR3 (NM_020360) Human Mass Spec Standard
CAT#: PH310587
PLSCR3 MS Standard C13 and N15-labeled recombinant protein (NP_065093)
View other "PLSCR3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PLSCR3 MS Standard C13 and N15-labeled recombinant protein (NP_065093) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210587 |
| Predicted MW | 31.6 kDa |
| Protein Sequence |
>RC210587 protein sequence
Red=Cloning site Green=Tags(s) MAGYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALFPSPGPVALGSAAPFLPLP GVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVR LADPGDREVLRLLRPLHCGCSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDADRQTVLRVVGP CWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDVRVKAVLLGATFLIDYM FFEKRGGAGPSAVTS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_065093 |
| RefSeq Size | 2089 |
| RefSeq ORF | 885 |
| Locus ID | 57048 |
| Cytogenetics | 17p13.1 |
| Summary | May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. May play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system. Seems to play a role in apoptosis, through translocation of cardiolipin from the inner to the outer mitochondrial membrane which promotes BID recruitment and enhances tBid-induced mitochondrial damages.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412530 | PLSCR3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412530 | Transient overexpression lysate of phospholipid scramblase 3 (PLSCR3) |
CNY 3080.00 |
|
| TP310587 | Recombinant protein of human phospholipid scramblase 3 (PLSCR3), 20 µg |
CNY 2900.00 |
