Mitochondrial ribosomal protein L11 (MRPL11) (NM_170738) Human Mass Spec Standard
CAT#: PH310613
MRPL11 MS Standard C13 and N15-labeled recombinant protein (NP_733934)
View other "Mitochondrial ribosomal protein L11" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | MRPL11 MS Standard C13 and N15-labeled recombinant protein (NP_733934) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210613 |
Predicted MW | 18 kDa |
Protein Sequence |
>RC210613 representing NM_170738
Red=Cloning site Green=Tags(s) MSKLGRAARGLRKPERGVSINQFCKEFNERTKDIKEGIPLPTKILVKPDRTFEIKIGQPTVSYFLKAAAG IEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSVVRSIIGSARSLGIRVVKDLSSEELAA FQKERAIFLAAQKEADLAAQEEAAKK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_733934 |
RefSeq Size | 762 |
RefSeq ORF | 498 |
Synonyms | CGI-113; L11MT; MRP-L11 |
Locus ID | 65003 |
Cytogenetics | 11q13.2 |
Summary | This nuclear gene encodes a 39S subunit component of the mitochondial ribosome. Alternative splicing results in multiple transcript variants. Pseudogenes for this gene are found on chromosomes 5 and 12. [provided by RefSeq, May 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406858 | MRPL11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC414217 | MRPL11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406858 | Transient overexpression lysate of mitochondrial ribosomal protein L11 (MRPL11), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3080.00 |
|
LY414217 | Transient overexpression lysate of mitochondrial ribosomal protein L11 (MRPL11), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
PH300033 | MRPL11 MS Standard C13 and N15-labeled recombinant protein (NP_057134) |
CNY 19520.00 |
|
TP300033 | Recombinant protein of human mitochondrial ribosomal protein L11 (MRPL11), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP310613 | Purified recombinant protein of Homo sapiens mitochondrial ribosomal protein L11 (MRPL11), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg |
CNY 2900.00 |
其它Mitochondrial ribosomal protein L11产品