RAB5C (NM_201434) Human Mass Spec Standard
CAT#: PH310698
RAB5C MS Standard C13 and N15-labeled recombinant protein (NP_958842)
View other "RAB5C" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | RAB5C MS Standard C13 and N15-labeled recombinant protein (NP_958842) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210698 |
| Predicted MW | 23.3 kDa |
| Protein Sequence |
>RC210698 representing NM_201434
Red=Cloning site Green=Tags(s) MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTV KFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLAS KRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASR SQCCSN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_958842 |
| RefSeq Size | 1791 |
| RefSeq ORF | 648 |
| Synonyms | L1880; RAB5CL; RAB5L; RABL |
| Locus ID | 5878 |
| Cytogenetics | 17q21.2 |
| Summary | Members of the Rab protein family are small GTPases of the Ras superfamily that are thought to ensure fidelity in the process of docking and/or fusion of vesicles with their correct acceptor compartment (Han et al., 1996 [PubMed 8646882]).[supplied by OMIM, Nov 2010] |
| Protein Families | Druggable Genome |
| Protein Pathways | Endocytosis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404416 | RAB5C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404416 | Transient overexpression lysate of RAB5C, member RAS oncogene family (RAB5C), transcript variant 1 |
CNY 3080.00 |
|
| TP310698 | Purified recombinant protein of Homo sapiens RAB5C, member RAS oncogene family (RAB5C), transcript variant 1, 20 µg |
CNY 2900.00 |
