TXNIP (NM_006472) Human Mass Spec Standard
CAT#: PH310804
TXNIP MS Standard C13 and N15-labeled recombinant protein (NP_006463)
View other "TXNIP" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TXNIP MS Standard C13 and N15-labeled recombinant protein (NP_006463) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210804 |
| Predicted MW | 43.7 kDa |
| Protein Sequence |
>RC210804 protein sequence
Red=Cloning site Green=Tags(s) MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYL RYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQETK KNFEVVDLVDVNTPDLMAPVSAKKEKKVSCMFIPDGRVSVSARIDRKGFCEGDEISIHADFENTCSRIVV PKAAIVARHTYLANGQTKVLTQKLSSVRGNHIISGTCASWRGKSLRVQKIRPSILGCNILRVEYSLLIYV SVPGSKKVILDLPLVIGSRSGLSSRTSSMASRTSSEMSWVDLNIPDTPEAPPCYMDVIPEDHRLESPTTP LLDDMDGSQDSPIFMYAPEFKFMPPPTYTEVDPCILNNNVQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006463 |
| RefSeq Size | 2979 |
| RefSeq ORF | 1173 |
| Synonyms | ARRDC6; EST01027; HHCPA78; THIF; VDUP1 |
| Locus ID | 10628 |
| Cytogenetics | 1q21.1 |
| Summary | This gene encodes a thioredoxin-binding protein that is a member of the alpha arrestin protein family. Thioredoxin is a thiol-oxidoreductase that is a major regulator of cellular redox signaling which protects cells from oxidative stress. This protein inhibits the antioxidative function of thioredoxin resulting in the accumulation of reactive oxygen species and cellular stress. This protein also functions as a regulator of cellular metabolism and of endoplasmic reticulum (ER) stress. This protein may also function as a tumor suppressor. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401945 | TXNIP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401945 | Transient overexpression lysate of thioredoxin interacting protein (TXNIP) |
CNY 3080.00 |
|
| TP310804 | Recombinant protein of human thioredoxin interacting protein (TXNIP), 20 µg |
CNY 2900.00 |

