PODXL (NM_005397) Human Mass Spec Standard
CAT#: PH310816
PODXL MS Standard C13 and N15-labeled recombinant protein (NP_005388)
View other "PODXL" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | PODXL MS Standard C13 and N15-labeled recombinant protein (NP_005388) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210816 |
| Predicted MW | 55.4 kDa |
| Protein Sequence |
>RC210816 protein sequence
Red=Cloning site Green=Tags(s) MRCALALSALLLLLSTPPLLPSSPSPSPSPSQNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSK ANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTAT AKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLM KISSSSSTVAIPGYTFTSPGMTTTLPSSVISQRTQQTSSQMPASSTAPSSQETVQPTSPATALRTPTLPE TMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICR AVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGPPE EAEDRFSMPLIITIVCMASFLLLVAALYGCCHQRLSQRKDQQRLTEELQTVENGYHDNPTLEVMETSSEM QEKKVVSLNGELGDSWIVPLDNLTKDDLDEEEDTHL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005388 |
| RefSeq Size | 5911 |
| RefSeq ORF | 1578 |
| Synonyms | gp135; Gp200; PC; PCLP; PCLP-1; PDX; PODXL1 |
| Locus ID | 5420 |
| Cytogenetics | 7q32.3 |
| Summary | This gene encodes a member of the sialomucin protein family. The encoded protein was originally identified as an important component of glomerular podocytes. Podocytes are highly differentiated epithelial cells with interdigitating foot processes covering the outer aspect of the glomerular basement membrane. Other biological activities of the encoded protein include: binding in a membrane protein complex with Na+/H+ exchanger regulatory factor to intracellular cytoskeletal elements, playing a role in hematopoetic cell differentiation, and being expressed in vascular endothelium cells and binding to L-selectin. [provided by RefSeq, Jul 2008] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401657 | PODXL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401657 | Transient overexpression lysate of podocalyxin-like (PODXL), transcript variant 2 |
CNY 3080.00 |
|
| TP310816 | Purified recombinant protein of Homo sapiens podocalyxin-like (PODXL), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP700181 | Purified recombinant protein of Homo sapiens podocalyxin-like (PODXL), transcript variant 2, residues Ser23-Pro461, expressed in HEK293 cells. |
CNY 6650.00 |
|
| TP700182 | Purified recombinant protein of Homo sapiens podocalyxin-like (PODXL), transcript variant 2, residues Gln32-Pro461, expressed in HEK293 cells. |
CNY 6650.00 |
|
| TP762498 | Purified recombinant protein of Human podocalyxin-like (PODXL), transcript variant 1, 273Ser-459Ser, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 2150.00 |
