LIF (NM_002309) Human Mass Spec Standard
CAT#: PH310818
LIF MS Standard C13 and N15-labeled recombinant protein (NP_002300)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | LIF MS Standard C13 and N15-labeled recombinant protein (NP_002300) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210818 |
Predicted MW | 22 kDa |
Protein Sequence |
>RC210818 protein sequence
Red=Cloning site Green=Tags(s) MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQ GEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNAT ADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002300 |
RefSeq Size | 3987 |
RefSeq ORF | 606 |
Synonyms | CDF; DIA; HILDA; MLPLI |
Locus ID | 3976 |
Cytogenetics | 22q12.2 |
Summary | The protein encoded by this gene is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Mar 2012] |
Protein Families | Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein |
Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400835 | LIF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400835 | Transient overexpression lysate of leukemia inhibitory factor (cholinergic differentiation factor) (LIF) |
CNY 3080.00 |
|
TP310818 | Recombinant protein of human leukemia inhibitory factor (cholinergic differentiation factor) (LIF), 20 µg |
CNY 2900.00 |
|
TP720015 | Recombinant protein of human leukemia inhibitory factor (cholinergic differentiation factor) (LIF) |
CNY 3140.00 |
|
TP723889 | Purified recombinant protein of Human leukemia inhibitory factor (cholinergic differentiation factor) (LIF) |
CNY 4000.00 |
|
TP750008 | Recombinant protein of human leukemia inhibitory factor (LIF) produced in E. coli. |
CNY 2040.00 |